Loading...
Statistics
Advertisement

Your Financial World
www.clarifyd.com/

Clarifyd.com

Advertisement
Conversion Technology Metas Server
Clarifyd.com is hosted in United States / Boardman . Clarifyd.com doesn't use HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 10. First javascripts: Jquery.min.js, Jquery.validate.min.js, Bootstrap.min.js, Number of used analytics tools: 0. Its server type is: nginx/1.4.6 (Ubuntu).

Technologies in use by Clarifyd.com

Technology

Number of occurences: 8
  • CSS
  • Font Awesome
  • Html
  • Html5
  • jQuery Validate
  • jQuery UI
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 10
  • jquery.min.js
  • jquery.validate.min.js
  • bootstrap.min.js
  • jquery-ui.min.js
  • incremint.js
  • scroll-script.js
  • modernizr.js
  • jquery.easing.1.3.js
  • faq_main.js
  • validation-login.js

Server Type

  • nginx/1.4.6 (Ubuntu)

Powered by

  • PHP/5.5.9-1ubuntu4.14

CDN

Number of occurences: 2
  • BootstrapCDN
  • Maxcdn

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Clarifyd.com

Missing HTTPS protocol.

    Meta - Clarifyd.com

    Number of occurences: 4
    • Name:
      Content: en
    • Name: viewport
      Content: initial-scale=1.0, user-scalable=no
    • Name: apple-mobile-web-app-capable
      Content: no
    • Name: apple-mobile-web-app-status-bar-style
      Content: default

    Server / Hosting

    • IP: 52.40.53.48
    • Latitude: 45.87
    • Longitude: -119.69
    • Country: United States
    • City: Boardman

    Rname

    • ns3npv.name.com
    • ns2fjz.name.com
    • ns4clq.name.com
    • ns1dhl.name.com

    Target

    • support.name.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx/1.4.6 (Ubuntu) Date: Thu, 18 Aug 2016 11:15:35 GMT Content-Type: text/html X-Powered-By: PHP/5.5.9-1ubuntu4.14 Set-Cookie: PHPSESSID=6hdm80s085nltearfd3f3ib641; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: unique_incremint=901477b86a4a3cd8562c2cb84f494d69; expires=Sat, 27-Apr-2030 11:15:35 GMT; Max-Age=432000000 X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Transfer-Encoding: chunked Via: 1.1 s_wx1123 (squid/3.5.16) Connection: keep-alive

    DNS

    host: clarifyd.com
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 52.40.53.48
    host: clarifyd.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns3npv.name.com
    host: clarifyd.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns2fjz.name.com
    host: clarifyd.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns4clq.name.com
    host: clarifyd.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns1dhl.name.com
    host: clarifyd.com
    1. class: IN
    2. ttl: 300
    3. type: SOA
    4. mname: ns1dhl.name.com
    5. rname: support.name.com
    6. serial: 1
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 300

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.larifyd.com, www.cdlarifyd.com, www.dlarifyd.com, www.crlarifyd.com, www.rlarifyd.com, www.ctlarifyd.com, www.tlarifyd.com, www.cvlarifyd.com, www.vlarifyd.com, www.cflarifyd.com, www.flarifyd.com, www.cglarifyd.com, www.glarifyd.com, www.chlarifyd.com, www.hlarifyd.com, www.cnlarifyd.com, www.nlarifyd.com, www.cmlarifyd.com, www.mlarifyd.com, www.cjlarifyd.com, www.jlarifyd.com, www.carifyd.com, www.cluarifyd.com, www.cuarifyd.com, www.cl8arifyd.com, www.c8arifyd.com, www.cl9arifyd.com, www.c9arifyd.com, www.cljarifyd.com, www.cjarifyd.com, www.cl0arifyd.com, www.c0arifyd.com, www.clmarifyd.com, www.cmarifyd.com, www.clparifyd.com, www.cparifyd.com, www.cloarifyd.com, www.coarifyd.com, www.clrifyd.com, www.claorifyd.com, www.clorifyd.com, www.claprifyd.com, www.clprifyd.com, www.cla9rifyd.com, www.cl9rifyd.com, www.clarifyd.com, www.clrifyd.com, www.clairifyd.com, www.clirifyd.com, www.claurifyd.com, www.clurifyd.com, www.claifyd.com, www.clariifyd.com, www.claiifyd.com, www.claroifyd.com, www.claoifyd.com, www.clarlifyd.com, www.clalifyd.com, www.clarlifyd.com, www.clalifyd.com, www.clar.ifyd.com, www.cla.ifyd.com, www.clarfyd.com, www.clarirfyd.com, www.clarrfyd.com, www.clariffyd.com, www.clarffyd.com, www.clarivfyd.com, www.clarvfyd.com, www.clarikfyd.com, www.clarkfyd.com, www.clari,fyd.com, www.clar,fyd.com, www.claribfyd.com, www.clarbfyd.com, www.clarigfyd.com, www.clargfyd.com, www.claritfyd.com, www.clartfyd.com, www.clariyfyd.com, www.claryfyd.com, www.clariufyd.com, www.clarufyd.com, www.clarijfyd.com, www.clarjfyd.com, www.clarimfyd.com, www.clarmfyd.com, www.clarinfyd.com, www.clarnfyd.com, www.clariyd.com, www.clarifqyd.com, www.clariqyd.com, www.clarifyd.com, www.clariyd.com, www.clarifayd.com, www.clariayd.com, www.clarifyyd.com, www.clariyyd.com, www.clariftyd.com, www.clarityd.com, www.clarifgyd.com, www.clarigyd.com, www.clarifbyd.com, www.claribyd.com, www.clarifwyd.com, www.clariwyd.com, www.clarifsyd.com, www.clarisyd.com, www.clarifdyd.com, www.claridyd.com, www.clarifryd.com, www.clariryd.com, www.clarif3yd.com, www.clari3yd.com, www.clarif4yd.com, www.clari4yd.com, www.clarifd.com, www.clarifyzd.com, www.clarifzd.com, www.clarifyad.com, www.clarifad.com, www.clarifysd.com, www.clarifsd.com, www.clarifydd.com, www.clarifdd.com, www.clarifyd.com, www.clarifd.com, www.clarifycd.com, www.clarifcd.com, www.clarify d.com, www.clarif d.com, www.clarify.com, www.clarifydt.com, www.clarifyt.com, www.clarifydg.com, www.clarifyg.com, www.clarifydb.com, www.clarifyb.com, www.clarifydx.com, www.clarifyx.com, www.clarifyds.com, www.clarifys.com, www.clarifydf.com, www.clarifyf.com, www.clarifydv.com, www.clarifyv.com, www.clarifydy.com, www.clarifyy.com, www.clarifydz.com, www.clarifyz.com, www.clarifyda.com, www.clarifya.com, www.clarifyde.com, www.clarifye.com, www.clarifydr.com, www.clarifyr.com,

    Other websites we recently analyzed

    1. constellationsystems.com
      Road Town (Virgin Islands, British) - 208.91.197.132
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    2. SVRUJI APPAREL
      Virgin Islands, British - 5.100.152.26
      Server software: Apache Phusion_Passenger/4.0.10 mod_bwlimited/1.4 mod_fcgid/2.3.9
      Technology: BootstrapCDN, Maxcdn, Font Awesome, Html
      Number of Javascript: 2
      Number of meta tags: 3
    3. tigertequila.com at Directnic
      Cayman Islands - 74.117.221.21
      Server software: nginx/1.5.0
      Technology: Html, Javascript
      Number of Javascript: 1
    4. Nettikasino Suomi • Rahapelit internetissä • Pelimerkki.com
      Ota suunnaksi suomalainen nettikasino Pelimerkin sivuilta. Esittelemme ne parhaat pelisivustot, joissa meidän suomalaisten kannattaa pelata rahasta.
      Netherlands - 188.121.39.233
      G Analytics ID: UA-52667467-1
      Server software:
      Technology: CSS, Html, Javascript, jQuery, Php, Pingback, Clicky Web Analytics, Google Analytics, Wordpress
      Number of Javascript: 5
      Number of meta tags: 5
    5. 2hover.net
      Switzerland - 141.8.225.72
      Server software: Apache
      Technology: CloudFront, Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 4
      Number of meta tags: 2
    6. 2015 Wedding Dress Fashion Trend Inexpensive Prom Dresses
      2015 fashion wedding dresses under 100, prom dresses, evening dresses collection, the most excellent designers and professional tailors guarantee best custom made dresses.
      Los Angeles (United States) - 155.94.236.167
      Server software: Apache/2.2.15
      Technology: CSS, Html, Javascript, jQuery Validate, Wordpress
      Number of Javascript: 8
      Number of meta tags: 6
    7. Defiance College Apparel, Shop Defiance Gear, Defiance Yellow Jackets Merchandise, Store, Bookstore, Gifts, Tees, Caps, Jerseys
      Defiance College Apparel and Defiance Yellow Jackets Gear from the tremendous Defiance Yellow Jackets fan store. Our Defiance Apparel and merchandise shop will help fans prepare for football, basketball, baseball, and lacrosse season.
      Coppell (United States) - 68.91.160.27
      G Analytics ID: UA-44540413-5
      Server software: Microsoft-IIS/8.5
      Technology: BootstrapCDN, Maxcdn, AdRoll, CSS, Font Awesome, Html, Javascript, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 3
    8. jeepbrasil.com.br
      Porto Alegre (Brazil) - 186.237.28.4
      Server software: Microsoft-IIS/6.0
      Technology: Html
      Number of meta tags: 1
    9. PLEASANTVIEWFAMILYHEALTHCARE.COM
      Jacksonville (United States) - 205.178.189.131
      Server software: Sun-ONE-Web-Server/6.1
      Technology: Html
      Number of meta tags: 1
    10. 1ï¼…ER TATTOO
      Japan - 210.188.245.26
      Server software: Apache
      Technology: Html, Html5
      Number of meta tags: 1

    Check Other Websites